PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G12420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 368aa    MW: 38878.4 Da    PI: 6.0124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G12420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  LPERR04G12420.1 14 RGQWTPEEDNKLLSYITQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding44.24.5e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T  E+  +++++   G++ W+ Ia+ ++ gRt++++k++w++
  LPERR04G12420.1  68 GEFTDSEEHTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.91965IPR017930Myb domain
SuperFamilySSF466891.98E-2911108IPR009057Homeodomain-like
SMARTSM007174.0E-141363IPR001005SANT/Myb domain
PfamPF002493.2E-171461IPR001005SANT/Myb domain
CDDcd001672.62E-121761No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2465116IPR009057Homeodomain-like
SMARTSM007176.9E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.36566116IPR017930Myb domain
PfamPF002491.0E-1268110IPR001005SANT/Myb domain
CDDcd001675.67E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRVPCCEKD NVKRGQWTPE EDNKLLSYIT QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF TDSEEHTIIK LHSVVGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPITHKSFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRPS LEFPSPSPAS  180
AAPIPDGAML AAPPPPPHDH DTIERIKLGL SRAIMSDPSA SAAAAAAAAK AEEDMSEGLA  240
GMYAAAYDAD EFRYDDGGAA AAAVVAGYDV LGGGGDHGAS MWSHQSLYSG SSGTEEANRR  300
TRLPPEKGND CSVGSSGGGG GGGGDDGDAA DDGGKDSGKG GGASDMSGLF ASDCVLWDLP  360
DELANHMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0342380.0BT034238.1 Zea mays full-length cDNA clone ZM_BFc0028K07 mRNA, complete cds.
GenBankBT0394220.0BT039422.1 Zea mays full-length cDNA clone ZM_BFc0012M19 mRNA, complete cds.
GenBankBT0406700.0BT040670.1 Zea mays full-length cDNA clone ZM_BFc0113I05 mRNA, complete cds.
GenBankBT0432400.0BT043240.1 Zea mays full-length cDNA clone ZM_BFc0129J22 mRNA, complete cds.
GenBankBT0549880.0BT054988.1 Zea mays full-length cDNA clone ZM_BFc0168O09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975922.10.0PREDICTED: transcription factor MYB12
SwissprotQ7XQN11e-174MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0D9W6400.0A0A0D9W640_9ORYZ; Uncharacterized protein
STRINGSi012130m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-113myb domain protein 103